PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03106.1.g00020.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27009 Da    PI: 5.4784
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03106.1.g00020.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-193286256
                                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                    r++ +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Zpz_sc03106.1.g00020.1.sm.mkhc 32 RNKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 86
                                    67789*************************************************9 PP

2HD-ZIP_I/II1222.9e-3933124293
                     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerL 80 
                                     +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+aL++ ydal  + e+L
  Zpz_sc03106.1.g00020.1.sm.mkhc  33 NKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESL 111
                                     79***************************************************************************** PP

                     HD-ZIP_I/II  81 ekeveeLreelke 93 
                                     +ke+++L ++l++
  Zpz_sc03106.1.g00020.1.sm.mkhc 112 KKEKHALLKQLEK 124
                                     ********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-201689IPR009057Homeodomain-like
SuperFamilySSF466893.26E-192190IPR009057Homeodomain-like
PROSITE profilePS5007117.5892888IPR001356Homeobox domain
SMARTSM003891.8E-163192IPR001356Homeobox domain
CDDcd000862.88E-163289No hitNo description
PfamPF000465.4E-173286IPR001356Homeobox domain
PRINTSPR000317.9E-65968IPR000047Helix-turn-helix motif
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PRINTSPR000317.9E-66884IPR000047Helix-turn-helix motif
PfamPF021836.5E-1388130IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEGDEDVPEW MMDPGGAGGG KGGKGGGGAV DRNKKRFSEE QIKSLESMFA TQTKLEPRQK  60
LQLARELGLQ PRQVAIWFQN KRARWKSKQL EREYSALRDD YDALLCSYES LKKEKHALLK  120
QLEKLAEMLQ EPAPKYSNNA DAGPRDDSRK GVTTGMKEEF SDVRPAPYAS SLEEGGGKLA  180
QHFAEDDART FFRAPSPQPS AGFTASGPPE HQPFQFHSSC WPSSAEQSCG SSQWWEFESL  240
SE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12127GGKGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001183573.11e-120putative homeobox DNA-binding and leucine zipper domain family protein
SwissprotQ651Z53e-89HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH353e-89HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLA0A0A9CR231e-124A0A0A9CR23_ARUDO; Uncharacterized protein
STRINGGRMZM2G041462_P011e-119(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-43homeobox 7